General Information

  • ID:  hor006426
  • Uniprot ID:  P51460
  • Protein name:  Insulin-like 3 A chain
  • Gene name:  INSL3
  • Organism:  Homo sapiens (Human)
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Expressed in prenatal and postnatal Leydig cells. Found as well in the corpus luteum, trophoblast, fetal membranes and breast.
  • Disease:  Diseases associated with INSL3 include Cryptorchidism, Unilateral Or Bilateral and Testicular Cancer.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0002020 protease binding; GO:0005102 signaling receptor binding; GO:0005158 insulin receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0001556 oocyte maturation; GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0007283 spermatogenesis; GO:0008284 positive regulation of cell population proliferation; GO:0008285 negative regulation of cell population proliferation; GO:0008584 male gonad development; GO:0010634 positive regulation of epithelial cell migration; GO:0043066 negative regulation of apoptotic process; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0090303 positive regulation of wound healing
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0048471 perinuclear region of cytoplasm

Sequence Information

  • Sequence:  AAATNPARYCCLSGCTQQDLLTLCPY
  • Length:  26(106-131)
  • Propeptide:  MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
  • Signal peptide:  MDPRLPAWALVLLGPALVFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:   Q8WXD0, Q9HBX9
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-P51460-F1(AlphaFold_DB_ID)/2H8B(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    2h8b.pdbhor006426_AF2.pdbhor006426_ESM.pdb

Physical Information

Mass: 322333 Formula: C117H186N32O38S4
Absent amino acids: EFHIKMVW Common amino acids: ACL
pI: 5.95 Basic residues: 1
Polar residues: 12 Hydrophobic residues: 8
Hydrophobicity: 18.46 Boman Index: -1977
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 75.38
Instability Index: 4650.38 Extinction Coefficient cystines: 3230
Absorbance 280nm: 129.2

Literature

  • PubMed ID:  8034302
  • Title:  A human cDNA coding for the Leydig insulin-like peptide (Ley I-L).
  • PubMed ID:  8020942
  • Title:  Structural organization of the porcine and human genes coding for a Leydig cell-specific insulin-like peptide (LEY I-L) and chromosomal localization of the human gene (INSL3).
  • PubMed ID:  7852540
  • Title:  The human
  • PubMed ID:  14702039
  • Title:  
  • PubMed ID:  15057824
  • Title:  
  • PubMed ID:  15489334
  • Title:  
  • PubMed ID:  15340161
  • Title:  
  • PubMed ID:  12114498
  • Title:  
  • PubMed ID:  16867980
  • Title:  
  • PubMed ID:  19086273
  • Title:  
  • PubMed ID:  10729310
  • Title:  
  • PubMed ID:  11095425
  • Title:  
  • PubMed ID:  10759163
  • Title:  
  • PubMed ID:  11746019
  • Title:  
  • PubMed ID:  11182749
  • Title:  
  • PubMed ID:  11383919
  • Title:  
  • PubMed ID:  11380919
  • Title:  
  • PubMed ID:  12601553
  • Title: